SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_28065 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_28065
Domain Number - Region: 38-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_28065
Sequence length 317
Comment | Brugia malayi conserved hypothetical protein (318 aa)
Sequence
MPKLSYSEDVGTKNGGIHFTNIMADSLEYLKKMLGLTPDCLNGGMKTLRGECICPKFYRG
HLCEELVCVNNGTLVKIPKLFPTQYTCRCPYPEYIHGQHCEHVKCLNGGRPMDNGHCKCL
DYWYTGQFCQEYAASWGVVLGLPLLCIVIMIICCVVCRLDLFPRKPTHSRKNSIYIGRRR
TPLSTICDEGTTSHRRRGLELNRSSNRTGNEIYLRMQENLLNDNGGESLAARPHNYFLSS
YIVHLNSVPVMDPNLTTDANSSKPFDPPPSYEEAVATFSTLQQPPSVGDAAVLPPQYSSY
PNQMLPRSQFSNAFRNR
Download sequence
Identical sequences Bm1_28065 XP_001897065.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]