SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_29580 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_29580
Domain Number 1 Region: 47-106
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000712
Family Chromo domain 0.0028
Further Details:      
 
Domain Number 2 Region: 589-699
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000187
Family Ankyrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_29580
Sequence length 712
Comment | Brugia malayi conserved hypothetical protein (713 aa)
Sequence
MTRTWEYTDRTENNGKXVMAXVSGVGTLNADETELVQLDTKSRTVGETYAVEXIVGIKTS
ETGEKLYKVRWKGFSESEDTWEPYENLTDGCDRLIIEYEVSQKSKNNENREHLLPSTSRS
NNSSEDSIERNNRHTLSTRWEYETVEVLTPDEWNRFGDVENRELGGLYIPDRIPTETEKL
LCNLAPDVGRVTRNKLKTVMKTENSPVDETRSSDGAKKQTARSRRRDGKKSVASTDIKKS
VDDGRRSVIKDESKVLANMSKAEEEREESLLLTFSERAATAKVEVPDELLLSECADNGLQ
IVAADTSTEDEGSAVNKNSSSFRNIGSRRSGRGRGGSRGRGRRRKDVAISPASSEVRPTS
AEFSDEVPNLVVDDMEPISDEERSNSIRESTARSHRGSSRGRGLSRGNKGKRATTSCGTT
VVDTSETSSNSIRLNKGRKRRASANTDDLVEERVSTTEETSAQDIPQNTCNTTQVLPTDD
ESDEPEPDVSMLEMLSFEIPELPLPLTNADISAIEIATIRRHQQNREKPLQTFEQFRSAV
LTNQLSAVRWTGRCVPERRGFDFNQKYRGKTVAIELCERPCGPAHETDDMLRQIVRDGAR
LDIPDDTRGRIPLHFAISCEFWCRVKTLLHLRSPVNTEDKDKKTPLHLAILTPRAPNFEV
TKTIYLLLEYGADVNEVIRKMTPLRNRYLSNLIDHQQRLSEAFDEARMKTLV
Download sequence
Identical sequences Bm1_29580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]