SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_29615 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_29615
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-32
Family Matrix metalloproteases, catalytic domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_29615
Sequence length 153
Comment | Brugia malayi Matrixin family protein (154 aa)
Sequence
MKTAFEEWSTVTQLNFIEVKRNGNIKIAFVSGEHGDGYSFDGPGLSLFFVISKILAHTLL
PPYGLIHFDADEKWAAMIITELSRYDTIDLLPTAIHEIGHILGLEHSWEKDSIMSPFYHY
QTINDDGEYVKPTLTNCDISRIQKLYGNRNASI
Download sequence
Identical sequences XP_001897365.1.25112 Bm1_29615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]