SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_29860 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_29860
Domain Number 1 Region: 126-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.63e-30
Family Astacin 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_29860
Sequence length 294
Comment | Brugia malayi astacin protease 7, putative (295 aa)
Sequence
MDHQIVVAFLLILLSLRIYGKSECMQIIGTLVCPQKSMLAGNVQIDLKDEDSLPWESHDQ
MGRTWSHADGSFMISGCGADFGPFNEPDPYIIIEHKCPSVLRSTIGNIGSTRKTQFALTK
RGSAVIFENDKWPNGRIPYVISSTYTLYQRAIIARAIAAYTARTCIRFTPRQLYDRDYII
ISKTDGCFADFAHVGGGPQQVSLADECLNYATVIHELMHVIGANTDFEKLTSVKLSYYGE
RYDYFSIMHYESTEGSRNGKNTVEARIQAITPLMGKSSDFSSSDINRINRAYKC
Download sequence
Identical sequences Bm1_29860 XP_001897413.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]