SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_30665 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_30665
Domain Number 1 Region: 129-264,326-410
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-39
Family Ankyrin repeat 0.00079
Further Details:      
 
Domain Number 2 Region: 448-636
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.73e-30
Family Patatin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_30665
Sequence length 651
Comment | Brugia malayi Patatin-like phospholipase family protein (652 aa)
Sequence
MFGILQKVRDVATMQNCEAVVNACGRAVAAVLSSKPEKVEAIDASKLKTFEKCDNSYTFA
LYVDKPKGVTYYVVYLPRSLKIWRTQERHQAELLRNQLNSLKLLVNILEKISSKFFEAEM
EQLRDSVIKNPSFNDIHHAAACNFPRVIAVLCKNRPSIVNDVSIDGYYPLHIAVENDAKQ
AVQVLLSLGAHTAKQDCHSRNAVHYGAGNNPEVLKLLAGAHDFLDAIDVIDKDGLSPLCH
AIRSAKAKCVEVLLDANCSTGPFPGGSLSAMVSMVALSPDLPRIVDLLLIRAPQFLVEEI
DGSSTILHEKLESKLLHRILGDLRNVVNINVRNNLGQTPLYCAVARNDLSQSFTLLTYGA
DLNIANYDGNTPLHISSKNGDVDLVKLLLCFGASAELKNGRGETALDVGRNKSLRLILAF
HLVLSDLMQEKVLVERQQMTPEEKQRLVNVISFDGGGIRGLILLQILMHIEKLLGHSVME
HFQWLCGTSTGAVIALGLAKGFLLAGYSLKHCQNLYLRIKDELFVGRRPYSNKMIESFFC
EIFGEETVMAQLRSKKVIVTASCVQKSPPLLKLFRNYTLPVSKAENKALGFDDPGENLVW
KCARYSSAAPTFFTPKDNFIDGGLISNNPTLDLMSDIHIYNAACMKVASYG
Download sequence
Identical sequences Bm1_30665 XP_001897572.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]