SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_31370 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_31370
Domain Number 1 Region: 112-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000135
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  Bm1_31370
Domain Number - Region: 79-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0033
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 167-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0407
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_31370
Sequence length 216
Comment | Brugia malayi EGF-like domain containing protein (217 aa)
Sequence
MSIAPIIICQQRHKDKDDAYVDLVPLNLIPEGCSLDSYYGYGIIDGSLEKCDKYSEAKAG
GEEFSSEYEEIKCRTLRVHGRMKNNKCECKPGWKGPICNEYYGCPTGFSLYNSVCTPNSC
QHNGTIAIGSKQIECMCKAPWDGRNCERLACWRMAPKEHERRWRNAGDKCRCADEYEGDN
CDKIIKCRNDGEVIDGRHSGPDPLPIRYNLKGKCNK
Download sequence
Identical sequences Bm1_31370 XP_001897719.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]