SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_31375 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_31375
Domain Number - Region: 297-380
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0712
Family MAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_31375
Sequence length 446
Comment | Brugia malayi conserved hypothetical protein (447 aa)
Sequence
MDATDFNAVKDEYLSLLTAPVNVQENLDVVQEASDLNCHGFDNNCRWSNTNEDELDWKVL
LSTPEAEPWISMLQTTHHPGQTIIRTVYNLDPDASAAVLLSGNHRTWGSGQLVSDLLPCI
ILPLQLTATVWRSSSDGPFQQQPNLQICSRNTNIDQTHSNCILFPIQNGMPVTVNIPEPR
DPTTPAQIILVGDNFVGKYGGAIFVQDIIVGGNLVPDCIITTPLTTKNFNKPQQQKAKRL
IPLHNFQDSSNSLVEVQELGPTQKMSNLQQSSILQFASPLLADSLMLECLKLSCNPAGKH
YESTEKYCGWQKGISGWMASTGTDGFSNPLSGIMVPPAGTNAFLVASYNSNSENSIRQII
SPMLSISTWTHPVHFCFYEYFAVEGARFTMCTDEFNKKCFYSKTGIPKDGHLQIYVSAEN
NGPNQGDIGFVPLRLSRDLDGNDPIC
Download sequence
Identical sequences Bm1_31375 XP_001897720.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]