SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_31510 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_31510
Domain Number 1 Region: 379-587
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.3e-30
Family PhyH-like 0.065
Further Details:      
 
Domain Number 2 Region: 80-198
Classification Level Classification E-value
Superfamily ARID-like 2.09e-24
Family ARID domain 0.0019
Further Details:      
 
Domain Number 3 Region: 241-296
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000432
Family PHD domain 0.0045
Further Details:      
 
Domain Number 4 Region: 1155-1210
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000035
Family PHD domain 0.024
Further Details:      
 
Domain Number 5 Region: 1360-1419
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000354
Family PHD domain 0.0088
Further Details:      
 
Weak hits

Sequence:  Bm1_31510
Domain Number - Region: 755-860
Classification Level Classification E-value
Superfamily t-snare proteins 0.0392
Family t-snare proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_31510
Sequence length 1430
Comment | Brugia malayi jmjC domain containing protein (1431 aa)
Sequence
MAGNGKFAKLYKQTPLNMLKNYSKYYTEFERPPFAPTFFPTEEEFADPIAYVAKIKPEAE
KYGVIKVKPPPSFRPPFAIDSEKFDFTPRIQKLNQIDGLTRARLIFDAQLASYWHMQGHR
FEVPNIDNKYVDFYDLYKAVMESGGVDTINAQKRWGYITKKIGFKQQRANKIKTLYFRWI
DAFQKLFTQDEDDEENTSDGCSNITNDTEIGQVECGGHIPQPRTKSMAGLRFHAKEKKTR
TSDPMDEVVCRKCEKGDDEDYLLLCEDCDYALHTYCCSPALSNVPRSEWRCRRCLLTSVK
EIAESYAFHDAHTSYNLLTFAKYANDWKQNHFHRDPLASYCTEVTSEEVEQEFWKDVIDL
ENTVVVKYGADLAVTKVGSGFPMNGRDFGGKMDPKEREYYANHPWNLNNLPILKDSVLSH
METGISGMMEPWVYVGMCLSAFCWHTEDHWTYSVNYLHWGERKIWYGVSGDEGEKFDRVM
MELVPYLFERQPDVLHHMTTTMNPKILMNKGIHVYTVHQEPGEFVITFPRSYHTGYNEGL
NFAEAVNFAPADWLRKGRFCILEYARVHRNCVFSHEELMVKMAKCATKLSTNVGIAVHEE
LYEIIVREKHLRDTVTGKGITQSARVEYEHIPDDFRVCIVCKTTLFMSSIICKHKRLVCL
EHADRICSLCHTADLTFNYRYTAQELNYMYNMLSYGICDYSTWKSKLLSAISAKSHAVKP
TLDDLRILVSVSKARCFPQCDATDEAMNIIKRSENIMQSARALMSRRIRTRNNLRKHANE
CPADIKDIEKLEQSIEELPCTILNLEFIVKNYVQRLEDWRKRCSQFLIDAIDYTDKYDYY
IDLANKLIEEADDFNVNLAEIDDLERVGLFLLAKTSPTKEENNFMVDKCHWLQCAHKILA
WTPENKSDSKTGNQNIVGLDQAKGRWRLSELMELIEKGRSIANDDVKFQIEIDALNVMLK
IGHQNEYVVQAFLRDKKNEGIGVEEAEKVRAVLEVSDWMTEEYTDKFRNEYKFARTVYDT
ARRLRGNKSYTLKSLSDLLFKIGKSFILRNSIMDSDIERLYDCVQCFCRRVGHMFALSPS
YYSIVEILNGRDDLTELIEGVATPLILVDPLSLRDNWAYIENFESVEQLTHHINSLYEQQ
RRLIVTLRKSNEARFIDEMCLCGSTKEEDSVIRCLLCHAKYHSNCVQWNPFMSQLPVGYY
LCVRCLRSRRPFVEDVKDACGTALPSLERMLVETALKHAEMAYTEALDVIGKLPPLDIPL
DAELCKSVDESLIAVFCNEIMNLEAWKLITNALIRVKPPTERDKAIYEQIKTRSISTQIP
SVLFPDSNGSKRRRGLKRSVLGSSKFMTHRKRSKNDFHQEQDVCSATTCLKPYSDHIRWI
QCEAGCSQWYHYVCVGQTVNRVDQTSLYCCHSCSSEGMCSSSGSVTSCPP
Download sequence
Identical sequences XP_001897747.1.25112 Bm1_31510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]