SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_31560 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_31560
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000055
Family C1 set domains (antibody constant domain-like) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_31560
Sequence length 107
Comment | Brugia malayi UNC-5, putative (108 aa)
Sequence
MDEIALIESPQSTYITRSRNATLTCRAVNATRIRFKCNGRWLDDSRHNMSQGTDTATHLP
FYKATVEIDRQELNIHPGDFTCQCYASTDSDVQVVRSESAHVRIACK
Download sequence
Identical sequences A0A0H5SHL3
Bm1731 XP_001897757.1.25112 Bm1_31560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]