SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_31565 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_31565
Domain Number 1 Region: 11-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.9e-45
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 502-586
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000293
Family Ankyrin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_31565
Sequence length 637
Comment | Brugia malayi Sex-determining protein fem-1, putative (638 aa)
Sequence
MNPDVYRVVVFNAARDGNLRRLRIFLEDRSDEWLHHCISSEELQTPPLVIAARNGHLDVV
KYLLEKGADISATGTVIFDGEIIPRAPVLWVAAAAGHIDVVRYLVEEAGADINQTTQSNS
SPLRGACYDGHYDIVHYLVKKGAGVELANRHGHTPLMIACFKMRADIVYLLLKHGADPCR
ASLRGNTAMHDAAEAGSNEIICMLLKAGAKNVKDGCNMTPVECGALAGHEDVLQSLSAVA
TAQEIRDTLKLYGATLVDKKMDLSNAIRVWFEAVNYGEPLRVRTALHVYDDLFEIDTADD
VRRVIGDPDAIRMQALIMRERIIGGDHHETHYFIRYRGAVYCDLGETNRCFQLWLHALDL
QQKHLCALHPSTVSTIGAFIDTFILMVNEGIIIANVDGVRVTPLSRKYLMDVLDKTVFEL
ERFNSSGMKIKTDEIFEEPGDDIRCSNFLMLASLQLILLIRRLSHNDSKLTVNLETDTDE
KDFDIALSNIVTRLILVSKCLNLYPLHAACHDIDKPLTTRFPCACVITMLIDNGIDVNTK
NSLGNTPLHTVLLSNNPRQSVIKLLLQNGATLLARNKENDTCLELISETLPRAFRLLKLG
RYLTLMGLAANAVRRNWLKTVYKKIVPKELFAFLDLY
Download sequence
Identical sequences A0A0K0JC15
Bm3835 XP_001897758.1.25112 Bm1_31565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]