SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_31675 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_31675
Domain Number 1 Region: 196-436
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-39
Family Ankyrin repeat 0.0003
Further Details:      
 
Domain Number 2 Region: 512-594
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000371
Family DEATH domain, DD 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_31675
Sequence length 601
Comment | Brugia malayi Death domain containing protein (602 aa)
Sequence
MQEANRRTEKFENLYITRPTKTVEKHLIQPAKTNQQCSTGVRKVDERWPKKEESIRIMVE
AATPCASSVIVSDIMHRDNAPLKVIEVSHNIVRNTKETIWLLLSKPVANVSISIAIGNRM
LPVERLKTHDKLVIFSLPILVIPDKVDKTSPATKSFKILMRSDTQQLELPMQVHVSATSN
ASDTAEIVDKEALIASLFEFAAEGEPLALVKPLVTLLGTPDNDGCNALHVAARNKQNFAL
KTILSVLCEYSSEAERQRILNAPNVRGQTALHCAVRAGDADCVHYLISAGAKRNVVDNNL
DTVAHYLGEAYNDAIYKEILETSSSEEVESGVEINRENILAKKNCYGYTPAHVAVKKLKL
SLLEALIEAGAPVDIPDNNGETPLLTALYMDDADAASLLAQHNCDVNVVSNCGDTPLKIA
CKKKNLVMIGCLLDAGSTMDSLGTGDGRPIEADDEDVQRILNGERVEVPSVYAQDDPGEQ
EINELQSEESISTATSTDAATSYRLRTLKDDVSCLDYLTRLRLSKILDVEDKWTILADHL
GCGHMVEFIRVCLDDSSSPTMMLLDQYEQVPNANLSTVKQSLEDMGETLGVRLIQAGNEQ
Q
Download sequence
Identical sequences XP_001897781.1.25112 Bm1_31675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]