SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_31690 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_31690
Domain Number 1 Region: 151-274
Classification Level Classification E-value
Superfamily EF-hand 1.07e-38
Family Osteonectin 0.00026
Further Details:      
 
Domain Number 2 Region: 85-147
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000383
Family Ovomucoid domain III-like 0.0026
Further Details:      
 
Weak hits

Sequence:  Bm1_31690
Domain Number - Region: 62-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family Follistatin (FS) module N-terminal domain, FS-N 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_31690
Sequence length 275
Comment | Brugia malayi SPARC precursor, putative (276 aa)
Sequence
MNVVAPLHLGILLLIISTVTGKKKKENDWDELETLLENIDEQITEPIKDSKLVSTTPVIQ
NNPCEDYICGWGKECVIDKKGEPFCECISKCPLMDDDPLDQVCSNMNQTFSSLCELYRER
CLCKHKFKECKNKVNAKVHLEYLGACKKLEPCTDELMVQFPTRMADWLFQVMREMKKRRE
LHNLEWEELIAEAESDDEKKHVYPVIWKFCDLDIKPHDKHVSHHELIPITAPVIPMESCI
KPFLENCDINNDGNISIKEWGKCLGLKEGEIQERC
Download sequence
Identical sequences XP_001897784.1.25112 Bm1_31690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]