SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_32030 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_32030
Domain Number 1 Region: 454-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.04e-56
Family Ankyrin repeat 0.0000115
Further Details:      
 
Domain Number 2 Region: 10-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000222
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 99-129
Classification Level Classification E-value
Superfamily Notch domain 0.000000824
Family Notch domain 0.0059
Further Details:      
 
Domain Number 4 Region: 136-167
Classification Level Classification E-value
Superfamily Notch domain 0.00000288
Family Notch domain 0.0029
Further Details:      
 
Domain Number 5 Region: 57-89
Classification Level Classification E-value
Superfamily Notch domain 0.00000615
Family Notch domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_32030
Sequence length 890
Comment | Brugia malayi notch-like transmembrane receptor, putative (891 aa)
Sequence
MDMKRNITLPLCLNGGTCVDGVNSYRCRCQRGFTGKNCQHQIDLEQFNVTDLLEHELCAK
HDCITKAGNKVCDQVCNYYACHYDSGDCSAGTKPFEKCESPSYCAHVFRDGKCDPICNNQ
ECLFDGFDCDSIPEQCSKNDYCTTHYADGQCDRECNVIGCGWDGGDCDSFDVETPLEGNI
IVILLISPDEFLHNAQTFLFTLSQKLRGAVHIRTINGKPMIYSWSSEGGIGQLYDVAPEK
RYLLVPNLQRVKRQTDQLRGTMVMLTVDVSYCRKIDREECFSDLFSIVDYLGAANAKQEL
QELGMPVHSARVELDNAKQAKGISWQTLLICLLIFVTTVLIAYSMVQQGRKRKTLHARIW
HPPPSESCKSSTGNLDTYSIHSGYLFSNYGTAKRSRADNIPVGIAHPNLYIGEDTQSFLK
PKTLSTDERQWTHLHEAADSTIPISLPIEPLLVNVRGKHGRTPMMQTASNQAKNEEASCE
DIRNLLEAGAEIDAQDDSEDTALMLAVKSGRTTVVDCLLKNGADPTIVDEKDRTPLHHAV
AVNIPNIVQLLLDTRQVNVDALDEDNRTPLIICSKFDIRMGTEIAEMLLKAKADVACAGD
KSLTKYDGRTALHFASQHANLDIIRLLIHNGANKDAQDSLDQTPLFLAASEGHLDAVECL
ISLGASKEITDQKERSPRDIAAEKEFRDIVHYLDTVPTPRILPSNMAATLALSTHQRFKK
SFKKTTRPVIKKNPSPTYPSAVTALTAQPATSVNPLTPPNSDGSNYSTTPSPHDTTAVVH
GGTAATRGTTVAQATAGHPENAVLQSSSVMLSPYSDHHNGTGCSPPQMMTAMQAGWLFPA
NQSSHQQYEEGLFYGTGMLPFVYDQRTLRPSYSQSHMPHVQQPSTAYYNV
Download sequence
Identical sequences XP_001897852.1.25112 Bm1_32030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]