SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_32035 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_32035
Domain Number 1 Region: 451-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000072
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 2 Region: 555-687
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000785
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 273-415
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000628
Family Growth factor receptor domain 0.0041
Further Details:      
 
Domain Number 4 Region: 489-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000386
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 130-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000174
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 168-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000223
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 7 Region: 17-134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000113
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 204-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000967
Family EGF-type module 0.022
Further Details:      
 
Domain Number 9 Region: 247-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 412-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000565
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_32035
Sequence length 693
Comment | Brugia malayi Calcium binding EGF domain containing protein (694 aa)
Sequence
MFISFFAGERCDRRNYCEGNPCRNGGSCISTTGGYRCGCPEGFHGNKCELDINECHLNPC
VRGKCINEFGSYRCDCPHDFTGRNCETLLFNIDPCSTSPCHNNAKCYTYRDKYYSCECRP
GFTGRHCEVNIDDCSENACMNGGTCIDREQGYECKCPPFYTGRFCEEDIDECELGLHECK
NGATCFNKKEGYQCVCVNGWEGIHCEINKDDCKDALCEAGSTCVDHLAKYTCECPPGRIG
LLCHMEDPCLSNPCQVGSVCEPDTSSGKYTCECPKGYTGEDCSNDINECNQDHAVCYNGG
TCVNTPGSFHCECPPGYTDWHCQTHVNQCSTNPCLNSGTCLDYGTRFKCVCMSGFHGKRC
ELHCPSGYEGENCERRQYIECSITDCLNGGVCSKGSCRCPPGFTGDRCEKKLDPCKYHNC
PQNAICIPINNSVTYKCECKLGFYGHDCKLEMNECASNPCQHGGVCTDHLNGYVCSCSAG
YTGEQCQTNIDDCIHHPCLHGGTCIDGINSYSCHCALPYDGDRCQYELDPCRTNRCENGA
ICKPTPTYRNYTCSCTNGFYGYYCDTDIDECAVNNPCLNGGTCANKFGSYHCRCSDGYTG
RNCESDRDDCLPNPCLNGGHCMDELNGYHCECLAGFTGRQCATNINECESSPCENGASCI
DHINGFECVCRRGFSGTFCQTNDDDCQPGYNKA
Download sequence
Identical sequences Bm1_32035 XP_001897853.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]