SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_32375 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_32375
Domain Number 1 Region: 2-150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000174
Family MAM domain 0.01
Further Details:      
 
Weak hits

Sequence:  Bm1_32375
Domain Number - Region: 195-319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0459
Family MAM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_32375
Sequence length 358
Comment | Brugia malayi conserved hypothetical protein (359 aa)
Sequence
MNDDLNWYRGNGFLDRNRLQVSTGTYSTPDGTYAIVATDRIMPTNSKATLISDVVTCQLG
PGELRFMYWISPEVRITVCLKRISQPYPNFDFCTSPIRGGSPGPAQLSIDDLGSEPFQIL
IQADNFIFHSANLEGGFAIIDNLEYYGDLCSDAAIVLINVRTRDFAASQVMHEGELSQIP
DMRNTLTVYKPVCEVLNCTFDDKDDQCGIDILNSLWSVARASVGRSRVENISSLFYKPAG
SFIYIEGPIAKTRLYTVSFQSTIDFNFVFAYYKTSNNSKLRAIIKMSEEPMEKIIFMIPM
QKKQTKRWYRELISLQAGFYDYAAIEIQDLNEDEYIGIAEFLVLDSQKRSICSQQRNS
Download sequence
Identical sequences Bm1_32375 XP_001897920.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]