SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_32600 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_32600
Domain Number 1 Region: 565-867
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.77e-69
Family Ankyrin repeat 0.0000102
Further Details:      
 
Domain Number 2 Region: 189-490
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.58e-59
Family Ankyrin repeat 0.00028
Further Details:      
 
Domain Number 3 Region: 26-172
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.32e-36
Family Ankyrin repeat 0.00021
Further Details:      
 
Domain Number 4 Region: 1052-1179
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.31e-19
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0074
Further Details:      
 
Domain Number 5 Region: 973-1029
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000721
Family SAM (sterile alpha motif) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_32600
Sequence length 1204
Comment | Brugia malayi Tnks protein, putative (1205 aa)
Sequence
MTPKRAEQQRQYTQVPTVTKNNNYLDRHHEEKCLKLFESCKQGDLSILLQLLKPETVNQP
DLNNRNSSPLHYAAGFGKVDCVRALLAAGANISQADDSGLVPLHNASSFGHIEVVKILLE
SGADTNVSDHWGFTPLHEAAIWGKADVCVLLLQHGASARSENSDGKTPQDLADGDAKAVF
TGDYRKDELLEAAKNGDEESLLCCLTPFSINCHAVTGRKSTPLHLACGYNRVRTVKILLE
KGADVQAVDIGGLVPLHNASSFGHLEVVNLLLEAGADSQAEDLWNFTPLHESASKGRLEV
VRLLAASGADPTRKTGNAKAPIEYITDEDVKKDILHEYAGYKIYAAAQIGDIRMLKSLLA
ERDPNYVHPCLKETPLHAVAGSAHQRRKVIAEILLKNGCPTDVLNKDGFSALHIATKLCS
YDVLEVLISHGVNISKPSSCGKTALHIAAEKGDFDLCKQLLNYGILTDLKDNEQKTAADV
ARNIEIRDLINCWSQEKINVIQKRCRGNKSVKHCHKQREGYKYCHESRNRGSDSGGNTVS
NKIETPKVCHNVLQRETQARYSEEVLLDAARCGDLCTIKHIIGSCGTRIINCKDFNGRES
TPLHFAAGYNRVEVLKYLLRKGANVEARDTGWLVPLHNACAYGHLIVAELLVKHGANLNA
TDKWGYTPLHEAALKGKFDVCKLLIINGADPKRKGRDGKTPLDVVREGAEDVYNLLRGDA
AVLEAAKHGDIEKIRKIVIPATVNCRDVGGRFSTPLHLAAGYNNLEVARFLLENGAEVNL
KDKGGLIPLHNASSFGHLEIAALLIECGAEVNHPDKWGYTPLHEAAQKGRTQICSLLLNN
GADVTLKNSEGFTALDITVTEDTKELLMVVILIFLKPIFGSVAACWKIGVIINFPYYLKS
CFVQNAVPVDLRELPAVHVVRKTSGSAVDVPISSFVWEIMDNAVVDMQSVNCSRQETNLG
SEKEDNENETKFSMEDYLRSIGLSSLSNLFAKEKITLDVLASMTHDDLKAIGIDAFGTRF
RLLKNIGKCIRKSEGNESRNSPSNVQVPVSIGTVLVQIEPSNEVFQQIEKALNSTIVSHR
DLGLGGMYTKFEVLEVQKIINKKIYERYIRRRGDIAEENYGEHNEKLLYHGSPFVHSIVQ
KGFDERYSYMGGMFGAGIYFAEHSSKSNQYVFGMAGSGCSLHNCYERIHYLLARYTTVLP
KLKS
Download sequence
Identical sequences Bm1_32600 XP_001897965.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]