SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_33555 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_33555
Domain Number 1 Region: 505-578,648-753
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-43
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 47-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000077
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 177-205
Classification Level Classification E-value
Superfamily Notch domain 0.00000536
Family Notch domain 0.0048
Further Details:      
 
Domain Number 4 Region: 90-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 212-243
Classification Level Classification E-value
Superfamily Notch domain 0.0000157
Family Notch domain 0.0067
Further Details:      
 
Domain Number 6 Region: 127-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_33555
Sequence length 893
Comment | Brugia malayi EGF-like domain containing protein (894 aa)
Sequence
MIVVLHFTWFTPVLLIAKQVYSQCCVAMVLINVALALLNCLLALPSCFDPAEPCLNGGVC
VKQVTNKAHSTLCSCSAGYSGEKCEKVLNVCEAFPHYCNAGTCVSINGSAICHCSMGYFG
HNCEYTFDKCKVGNMCRNGGTCIDGICFCTDGFSGEVCERHVPERDDYLRAGCEEHPEFC
ALRFADGTCNEECNNEKCFFDGFDCVVSTQECRLSDYCALHYLDGKCDEKCAVAECGYDG
MDCDRNMLLRDLTDSSTIGIKLHNPVRLALDSNNKTRIYEWSFENGVGKEINLREWEMSR
NATSVLLYVDIDSTFCEQRLHLNTTNVLPCFTDIFGAVAYLHTALYDEAKNRISLGDVTV
EGLFVESDRSRSLPIFAIFITCFVFIGMILSCFYGIYGFFDVLKRQNIGKNHAPVWKVPS
SLQSNATSWSTVSSVEDYLLNEDICRRDGLPPLSRLFSNSTSCRREQPKDFKNHYRTAKN
NEQKILISLDAYFSDNGNENCHLGPDLLKAVKCNDIEAVSFLVLHGADVNCFDSDKNTAL
HHAVVVNNDQIIRLLLSTHRCNLRAVNVLGQTPLTLTVKFAHVSDLCARCILDFMYTEYY
RQTKVRNDTFTPQLISSQNGVSRLMTSNNYREFDPSLKQPERDGCIFTRDILSEKDDPTL
TDIFGRTALHYAALNRRVNLLPILYSFGLKLDTEDTKGETPLYLAAREGYLDMVNLLLSF
GANSEISDQLGRTPLDVARERGHCFIVEFLENAAVNNVDIMKTRKRKRSRKPSSAAKCKS
KLGSYIPVASSQENISLTSSSIATGLNDDYTEDVGDIDEDMTISSSFLNSVESFVLTPAG
QIIAEAEKELDLDVVDPAVPDYIDLSTNSCLPTEFFSNNAFSVEPFQVRRSSE
Download sequence
Identical sequences XP_001898157.1.25112 Bm1_33555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]