SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_34120 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_34120
Domain Number 1 Region: 725-751,788-935
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-24
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 2 Region: 546-723
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-18
Family Laminin G-like module 0.043
Further Details:      
 
Domain Number 3 Region: 983-1166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000493
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 4 Region: 189-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000255
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 5 Region: 1496-1622
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000235
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 1360-1395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 7 Region: 50-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.006
Further Details:      
 
Domain Number 8 Region: 1281-1318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 153-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000122
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 1322-1359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000122
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1433-1470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000219
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 12 Region: 1203-1319
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000345
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 13 Region: 420-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000453
Family EGF-type module 0.019
Further Details:      
 
Domain Number 14 Region: 229-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 1398-1439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 377-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000762
Family EGF-type module 0.039
Further Details:      
 
Domain Number 17 Region: 303-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000865
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  Bm1_34120
Domain Number - Region: 343-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000141
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1472-1507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000659
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 963-1016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000876
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 92-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00492
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 487-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0195
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 1637-1676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0247
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_34120
Sequence length 1748
Comment | Brugia malayi Calcium binding EGF domain containing protein (1749 aa)
Sequence
MKVYIGTKLSDSDTKEKVMIGLARQSLLSQLCRTGIVKVLLERLNGFLTLRHCESNVCLN
GGTCKVNDQDRTFRCLCPVGFEGLLCESEKVCSLKCHNNEVCIFTDVGKPKCNCSEEFSG
ELCEVGSIDCQVQGCSIGERCVLVEGGKWHCVHDACIPNPCQHNASCTLVKDRFECACTG
GFEGSLCENDIDECITTPCKNDAICVNSLGSFICLCKDGFRGTVCEESTLCDPNPCFNNG
ICSIVDGLYHCNCQPGFTSDRCQEQIEEECNCKSDKQICISGICRCPDGFMGKDCDQPLS
WSCIRNESCENGGTCLEATGGCLCPPAFTGIRCEHTLECIVDSNPCIHGNCIWSANGATC
NCENGFEGKYCERNSPEFDPCLRRDCNSGQCVVKGGSAVCICPEENSGEFCENTDICETM
PCLNGGKCFTNFTNMSGFKCICDERFSGTRCEMRVQEMECVPECVEGESCEQRNGTFVCI
KTEISCDDCVHSFRCIENGKYAVCVCDTSWTGPKCDQQIKECQNLFCTQYQICRNEPTTA
GTITSCGCAPGLTGTNCTINTAVTFHNTSFFLYQSPNSVVGLQKSDYTLKVTFRTTVDDT
HILSTEDILSQMQFALNVQRGYLYGNFTGFVYRKLLPFAVNDDHWYTVLFSNINKTVSLE
IREGDFVLSRLKMKERRNMGIYWTRIGKGRANGFRGCVRDLFINGEFTNMLKSASVFGVI
EGCQHSKLCSPNPCQNGGTCIDQWDEFRCACKKPFLPPYCIQQTDEVTFGHHNLKSRLEL
DIEQNLENIKLDTDIDFLMRTNKPNGTLLYLGEKSNEDIGTFIALQILNGSLNIRTRLGG
KKVFSRNISDKIDDNKVHLISLVRDRNNFTITIDDGVASTKFDIENRFDHPLLADTLILG
SSEDLPTDAFSNNDYFKGTLQDLRINNRVVPLTTLPTDIEVQQFGIEIEKDNIQQGTVSD
DICTLLKPCVNGECSNTFNDFECICENSWIGKRCNRRDHCALSSCGTNMTCTNYDGGYVC
SSPATFISTSFAKFKLENGGVAMDISKSLQISFMLRTRSLSGQIIYLKTPTSFLSVSLED
GLLVYEALINDNMKKQRTNLVVNDGVVRSVDINQNGLHIDGKLNANNLSLPLLVNTFGIN
DNLTLIIGQRSDQLPSFDGCLENIHIGITPPISFFVDGRAGNLLENTMHFKLMKRRNIID
NFCYADDLCGLVNPCKNDAVCRDLWNKRVCECQPGFTGTFCETRINRCENHICKFGACIS
GIDEYSCVCLPGYDGQFCDEEMNLCKLSPCLNGGNCTTAKGKYNCDCPPHFVGSRCQVLK
SSKCLPSPCENGANCTVVKDTFKCDCPPGFDGILCDIQKDICQSNPCKNGATCLPKDGDF
KCICTNGYEGRICEEMKDYCSTSPCVHGECITVTDNFLCNCESGWNGEHCDIDINECIRF
PCEHDGNCTNTPGSYHCSCDSYHLGDHCEVVGSCVERPCGDNGDCIQQTSTTHSCVCRRG
YTGDTCDMLIDYCSPNPCENGATCQKFIGGFSCSCLAGFAGETCSLDIDDCINEVCRNGG
HCMDRINGYECDCEGTGYRGTHCTEDIDECELGVCVYGRCTNLIGSYNCICDIGYMGKRC
TVEDPCTLDSLNRTRHDCVHGACVHPTVSMKNDMEVANYECECEFGYGGEYCIHLVEKSR
SVSLGYIVGPMLALIIALLIIGFVLLAVVMIHGRRATQGAYSPSHHESSISRMPMNSMLK
SPPEERLI
Download sequence
Identical sequences A0A1P6BXB7
Bm1_34120 XP_001898272.1.25112 Bm3309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]