SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_35360 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_35360
Domain Number 1 Region: 355-525
Classification Level Classification E-value
Superfamily Lipocalins 1.35e-22
Family Rv2717c-like 0.0056
Further Details:      
 
Domain Number 2 Region: 263-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 155-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 4 Region: 195-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 230-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000576
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_35360
Sequence length 543
Comment | Brugia malayi EGF-like domain containing protein (544 aa)
Sequence
MLLPSFVAKKGKPVESPKNSHHYKRVVSAAENTGNFTIIDGKASSIQYTIYEKHMLQRPS
IPETLRDLAYRHENEVEEEINEKEPSTHIPFTAPLEESGNPTPTRFPLTRTSVSWKPQTE
KLDGFEHVYEGRFPKIFMGNVPTKTKLKMTTITGMDKCXENPCENGGRCRLDTGAEVGFT
CSCKEGWTGPLCQTKDHCVGHSCVSGKCVNMKDSYQCVCWKDYAGKFCTRKCDPNLCRRN
GTCVEKSSGELGCKCPPGASGRYCEREINECNFRRCKNGAKCTDKWNDYSCICRPGWMGK
DCDRPCQDIYGSCDQWKQQGQCEQMRDHTRFFDDNCAASCGQCTYSNETVKTTKPLAPIL
LPLSWMIGIWKAEVNGTRSRTIDYVTDFEGISYTEILTITVADVLVFGKPSINFTSIAIN
RNDSTDQHIHYGFFTISPNPEGKPLVALITASNLGQIMIEEGELRSNSIQLTPVYRSVLS
YTANSLPLECDNNVQEESFYFQLHRTFSRTDKRLVQSLTKKDLDGRNRSISKRYDKIVNI
EYL
Download sequence
Identical sequences Bm1_35360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]