SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_35440 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_35440
Domain Number - Region: 7-103
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.01
Family Astacin 0.016
Further Details:      
 
Domain Number - Region: 283-317
Classification Level Classification E-value
Superfamily E7 C-terminal domain-like 0.0366
Family E7 C-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_35440
Sequence length 430
Comment | Brugia malayi ShTK domain containing protein (431 aa)
Sequence
MDAKKENQWKQQTIPLWISPAYSRRRWEQLADLLFQVQNRTNIKFRSFIKERDNDYISVK
TTTYGCYGLLGYGKGGERWINIYDECIEYSHIVLRSIYQILGFQMIAMKEPEGNILYFGA
DSEIGYLKFVVWKDKFIVDSKKLTEETNEEECIGMETATSMMCHQPNMEFFYWSKVYENL
IHSYPYVDDPLFGRVYRRTRNISNHDIFHVNRIYKQANKDSSYRLHDFANPSMYRAEDFQ
KMPNVIIGLADLYCEDSLVDCDFLHKSRGHCNSFQEFRYILCARTCGMCGISLRLYYIST
HHPFLYIQEKTEHQLPICTDDLQAVLNGTCSHTNLHNCLLPRFREKCRRSCGYCPEQSRV
DCEFDEKVAINPITDCMLSCGHYACSRGDIEEDMGHGQVPVMQLYVPQNEWQFATLGSLA
SFEETNSSFS
Download sequence
Identical sequences Bm1_35440 XP_001898535.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]