SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_35535 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_35535
Domain Number 1 Region: 184-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000124
Family EGF-type module 0.0095
Further Details:      
 
Weak hits

Sequence:  Bm1_35535
Domain Number - Region: 155-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000318
Family EGF-type module 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_35535
Sequence length 639
Comment | Brugia malayi DOMON domain containing protein (640 aa)
Sequence
MLQLLLLLHLLLRYSAVGHVALTFPSARFPPLDFLDSAXTISPCGVPKPDSPRYTQLYVG
ESYNFTWRLQYPHQGGYRLSVINETGDVVEQLAPLKGSKYVGLDDQTLQHATVRPTRPCT
PCIVLLERQALEWGQAYEFRSCADVNIVQEVPKDDERCSKHGDYENGKCKCRHSYSGELC
QYKDYCSTDDDCLNDGKCVKEANGIVRRTCYCSFGYFGQNCDRTFDAKPENDKCFNYDYP
KDEKKYNKYGLFGEECFKKIALNENDFVYSRVVQDELEIILDYESTSWISXGWRPMEIDR
SCRLFPDLENTRNKRDTRWTLISHSTIQMNESQYRSPIDLNLMPVPIPKLPENNGLLRAA
LLAPLHPMDCTDIVIGSVRDGRSRINDMYTRDRSTPLYDIWLDGEESFSAAYGIERDGRT
IVMFRRRIAEIEPSDHPLGPGEIFVIYAKGQMMGSYSHAVKSALDQGPISDHNFYRQDEV
KYHGNRNRGVHSVVFVSVDEQFPSIRPPLRSRHPDPSSLQHPAAAVHNSFAHGAEVPKAT
QAVSLPTTITSERSSSISDMMRRPSLHLNSKTEPTVKKESLLIQSEPVPEPEPELELEPK
LNSREIDYLYFDNGSLMLNTFQLVYFFFFLFFLLSHCYL
Download sequence
Identical sequences Bm1_35535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]