SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_35715 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_35715
Domain Number 1 Region: 114-279
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000000144
Family DPP6 N-terminal domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 400-505
Classification Level Classification E-value
Superfamily F-box domain 0.000000719
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_35715
Sequence length 527
Comment | Brugia malayi conserved hypothetical protein (528 aa)
Sequence
MPPHDEQYLVEEKSWSELLSHARLWRNISKKRMNMTLHHFSLYIDHSGTERMLALGGSGQ
SPQETIYTAPLTRSPLVSSVAKLTLCPYLDTKPSKGGPPPAELAALCERQRTTVSSGISS
YDFDPTSFTLLYSDSTSLYRIQKEEKSVIGNGIKGCPLHAQLCPVDNTLVAFVANSNVHI
DWKGEVIYSSSTGDNIINGCSSFIAQEELDRFTGMWWSPGPRKMLLYEQVDETAVTSLQF
TIPGCSPARXMKYPVAGTANAVSTLRLIVIDGNKFVGCTSMSEAFHRLDLARAVSDVRRF
NYICKVVQILVQEKLQNLSATARKALLSIIKAIVLICVERDLHISIARSLVCDFGTGLEG
HLYGSPQLVSKQLNMIGDLLELISEQRPRTLADXDEESVTFMDLPREILSIILRKLPDHV
SLLEVAKAHEVLDAIVKKEEQLWASLCSFHFTQEQTAKIKKDPISWRHAFFELKKHCGLR
EFYADLIHLCCHCKAIFWKDHGHPCISKDTPSVRVTPQQFVDMLLLL
Download sequence
Identical sequences Bm1_35715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]