SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_36225 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_36225
Domain Number 1 Region: 195-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  Bm1_36225
Domain Number - Region: 249-331
Classification Level Classification E-value
Superfamily YWTD domain 0.0011
Family YWTD domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_36225
Sequence length 339
Comment | Brugia malayi Calcium binding EGF domain containing protein (340 aa)
Sequence
MKPFLIDRQPTADLNETVPDWSDRQPTADLNETVPDWSDRQPTADLNETVPDWSDRQPTA
DLNETVPDWSDRQPTANLNETVPDWSDRQPTTDMNETVPDWSDRQPTADLNETVPDWSDR
QPTADXNETVPDWSDRQPTADLNETVPDWSDRQPTADLNENIANASSNSDLQTCNNCKVI
KCPEGFYYNKHLAKCVDVDECASNKHFCSQKCINKQGSYDCECFGPLYRLARNNRRCYRT
DNESVVFFLAHSHSVWNITYNAKSQLKLVPSNRAEKVAMFDYDLKEKKLYYVDLTRNSIQ
YVNLLDRNRVHIIQNHDIEGTEGIAIDWIHRSYGLQLKA
Download sequence
Identical sequences Bm1_36225 XP_001898691.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]