SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_36300 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_36300
Domain Number 1 Region: 87-183,318-416
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-31
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 2 Region: 421-523,807-904
Classification Level Classification E-value
Superfamily Fibronectin type III 8.12e-24
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 609-711
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000182
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_36300
Sequence length 1013
Comment | Brugia malayi Immunoglobulin I-set domain containing protein (1014 aa)
Sequence
MCDVRTIPNALETIAISTSCRTEWSKVSPCLADGRNHTDCCIKKGVQHDCLKICGGVAEP
LTMHSLLCLNLDIAAIYQCLRQGYDTRPSPPQNVTVTTVTENSAEVEWTEPAVNAHLVVS
YSLFLRKDDRSPNVIEVHNVTSPHTEYGLTPDTEYTVYLQSHGTTGDSLMSTAQVFFTHP
LVSSFCPHGEPLYDPNGHRYYCGAGIRDCPPNYDCVVAGTSETDTFCCSKPLKINLAKDC
CQQRGVPANCLSMCSNSTPLTLECSEYGDIWVQCTSEGHDHTRCCAESGIPDECISACRH
PFTFERSCIEYTPVLAKCFSWLTTNLPSAVANLEVTSRNSSSVIFSWDIPLQRPADVYQV
TLEKSTSVFRQINVTTNSARFDDLQPSTNYTAFVTAFNKHGSSPPSFKISFETLPDNEQN
DRPVPPFGLHIVWNHGRRINITWNWSSVRYNGQRITGPVTYTVNYVSTGNASVWNSVKTQ
NMWHVMENLTMNSLYEVYVYVSDGNLQSRSSSVVTVLAAPDEYSLPEPQITITPENANRT
YRVNEQIAVKCTVHSDRVLNLDLLIGKTLIHSEPSKMTVETFLNVAENNNLITCTVMDTD
GRQNRAQMHIFVQFGPIVNMVTEQIYAYDDLSAEIQCIVQGYPEPMLEWHYQKSPNAIRT
ERLNDPVLVKTTALNQYVHTLLIKNVTGRNGIYSCKAVGADGTEITKSAELNIAKAALPL
TPRFILQCCVEAKISEKCLRVCSVNPEIDSDCSAFSEDLLRCANDGRDHRACCMKTRIPS
DCLGMCSGNKVSNNALCSIFAPRAVACMIRGHERAPSPPTLLRYENVSPDSIKISWNETE
ADPYKVYAIYYRQENSNGNFTVVKTSNTEVVIDGLDPNTNYDLALVSANALGHSPFLETK
IINTFGLTRSHTFISAFFFTFLVAAAASFVVYTIRTNAWLRVIQKLHRSQPLSDRDPSVA
FENPGYGTEVQIRGLAHSDPIAATEWQNADLEVADNLPTEANNGMRYAKLNSS
Download sequence
Identical sequences XP_001898707.1.25112 Bm1_36300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]