SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_36305 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_36305
Domain Number 1 Region: 273-326,388-431
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000136
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 2 Region: 29-66,113-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000801
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_36305
Sequence length 503
Comment | Brugia malayi Fibronectin type III domain containing protein (504 aa)
Sequence
MVQLLLVLLYCIVLRCETKELHLTTSDEGYMTVIQGFAARLECMLNTCVRHASTVIWLKD
DVPIFNSTKFLDNSGVDANSVLLQHNIETDKDKECTGSCSDTDACSDGSHCMDNKCCQCA
SEDFTLVLKNLTFEDAGRYRCQISNQPQQLEFQLEVLESGLKGGFHENISYDYSKCCAEK
GISPLCQAMCKPRDMHIHHFDPTSCKTDDYKNFLSCATEGGNRSHVQCCKTQLVPSFCYD
FCSGNFQMLRKSHRLCLYYLPEIFECYNRAYLPFPEHPQDLTVNAIRSDELRVCWRPPQP
QTSNKHLGIDHYTVYYKQIPSFPFLGGDDGIPLLSGDYEESIPGGMAEDDIAGDITPSDV
GSLKRGKRQTWLFVTHDSSTNDSTVREFKFDEVNTTDTCVTLKDLRSATRYIVYVTASNE
YGMSVPSSRALAATNAIVTPINSTLPQIERIPYSFVQIFVVPLTTSLRSIVEGRKRLPLS
NTKITYPLYKEFSTGRKPEIIVP
Download sequence
Identical sequences A8Q167
XP_001898708.1.25112 Bm1_36305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]