SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_36930 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_36930
Domain Number 1 Region: 5-208
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.13e-40
Family Ankyrin repeat 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_36930
Sequence length 305
Comment | Brugia malayi CG1651-PD, putative (306 aa)
Sequence
MIQNYRKWDALNELHIAIRANKPGLVLYTLQRHRSLNINSNLMRTSALSLAVRNQNESIV
RILLDYNCELNKLSSDESGRLETPLYTAVRLHNYAIVELLLMYGADPNVTVSDNRTPLYI
ATKERCLNICNLLIAFGANLDIPDCTGQTPLHFACRNIAGREQIAMLLIAHGANVHASDF
KRRLPLDFAEINASIPTIKRLIEEGSPISKHMKERIRNMLQDKSDQRGRTDRINGENCAL
ATVIDKTHLVVPTLLILSKARIRNLMRQQAKRIQNVCSIWPLIDSLPMLSNSLRNSLKLL
DSFLP
Download sequence
Identical sequences A0A0K0JYE8 A0A0R3QZR5
Bm9191 Bm1_36930 XP_001898833.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]