SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_37020 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_37020
Domain Number - Region: 33-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0112
Family V set domains (antibody variable domain-like) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_37020
Sequence length 97
Comment | Brugia malayi hypothetical protein (98 aa)
Sequence
MQCSFAPEFRNRTRYEPSWTVVAGDLPRHLTRNGVSFSKQHYELLQTNGAYNLKIRHVVF
RRDNGKFFCTLLDKESGAQYTVQANVVVVGLFTYMII
Download sequence
Identical sequences A8Q1W8
Bm1_37020 XP_001898851.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]