SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_37090 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_37090
Domain Number 1 Region: 140-244
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000113
Family Ankyrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_37090
Sequence length 607
Comment | Brugia malayi Conserved hypothetical protein, putative (608 aa)
Sequence
MKMQQSKQQEGYYAVYIPSPDGLSGEGAVFTTLREASSFANTPESKTKGARFKRFKDQDD
AKKYAKNGDMFCKSPEISAKSHTGEPTSSFPSVSRIMFNRLKKAIELKDDELFLEMALQN
PRYLINIGSDTPTIVVEGFRYNAMHLAAKVGNLHVAKYVLHLVCDSQVLLALYGTSEDDV
KMRSRLLLDCYLNMPDKGSHDTPLHFASKFGHYNLVELFLSYSICQKNPTNKMGFTPAQI
CCTRYVGCDKKNLCAVMISLFLCFFVALYRPTDNYYSIIIQLLDETPPNTLPDDAPGSFV
CMSAFETYELAAYAGPFADKAVAQEFCETWKIEERDCRRLYPRKGAERVGRCLANKYKIT
WMERWSFCNKLLDFQSYSGLEELNRHLVNIRLHPPACSIRTMNCDCDNDSVVFSGVCDTA
LNDQRSENDDCKTDDLHNTSLVHFSQITEFTELETLSTDRFKKLANLHLDSSSSSSETLL
NSGDYISKDYVSFAENLITSESPLTSDLNIVISPAQLKQTNSNNERNDSIDFDYYTPPSS
PEPIYIYEGIPSKDDEELVTALSLVDPHLIERFGAIFEYMRHVRNVPEAERSHWPFTDSP
RAKRRRM
Download sequence
Identical sequences XP_001898865.1.25112 Bm1_37090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]