SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_37330 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_37330
Domain Number 1 Region: 446-834
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-125
Family Ankyrin repeat 0.00000000157
Further Details:      
 
Domain Number 2 Region: 211-461
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.74e-69
Family Ankyrin repeat 0.00000393
Further Details:      
 
Domain Number 3 Region: 57-274
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-54
Family Ankyrin repeat 0.0000253
Further Details:      
 
Domain Number 4 Region: 1524-1613
Classification Level Classification E-value
Superfamily DEATH domain 9.76e-16
Family DEATH domain, DD 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_37330
Sequence length 1896
Comment | Brugia malayi Uncoordinated protein 44, isoform e, putative (1897 aa)
Sequence
MNMRKFCRRVTNKTQLLMINPAVEAGGWPAEVPKSQQQQVPSDNSQHSNKGESSASFLRA
ARAGNLDRVLELLRLGTDINTCNANGLNALHLASKEGHHEVVRELLKRKADVDAATKKGN
TALHIASLAGQELIVTILVENDANVNVQSLNGFTPLYMAAQENHESVVRYLLAHSANQAL
ATEDGFTPLAVALQQGHDRVVALLLENDTRGKVRLPALHIAAKKDDTKAATLLLQNEHNS
DVTSKSGFTPLHIAAHYGNENVALLLLEKGANVNYQARHNISPLHVATKWGRANMVSLLL
AHGAVIDCRTRDLLTPLHCASRSGHDQVVDLLLEKGAPINAKTKNGLAPLHMAAQGDHVD
SARILLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRNADSNARALNGFTPLHIAC
KKNRIKVVELLLKYHAAIEATTESGLSPLHVAAFMGAINIVIYLLQQGANANVATVRGET
PLHLAARANQTDIVRVLVRNGAQVDAAARELQTPLHIASRLGNTDIVILLLQAGASPNAA
TRDLYTPLHIAAKEGQEEVAAILIDHGSDKTLLTKKGFTPLHLAAKYGNLPVAKLLLERG
TLVDIEGKNQVTPLHVAAHYNNDKVALLLLESGASAHAVAKNGYTPLHIAAKKNQMDIAS
TLLHYRANANAESKAGFTPLHLSAQEGHREMAALLIENGAKVGAQARNGLTPMHLCAQED
RVNVAEELVKENAATDSKTKAGYTPLHVACHFGQINMVRFLIEHGAPVSATTRASYTPLH
QAAQQGHNNVVRYLLEHGASPNVQTSTGQTPLSIAERLGYVSVVEALKTVTETTVITETT
TITEERYKPQNPEAMNETMFSDSEDEGWISSVVIVLLNALVVVVVERLFVDSAPNTLEED
ASHLRVLTHSPLRLSTDDHDLSFFPNHTSSPYPSPGATLIYLSRDDNQITANAHAHDFSE
SLTKGLHDSTGVHLIHATEPMLSKSPEVEGVDGDLDALIRKAQHEPVTTAMVDPSLDSSL
SDSVPVTRTTVQPSFLISFMVDARGGAMRGCRHSGVRIIIPPRKAPQPTRVTCRYLRKDK
LAHPPPLSEGEALASRILEMAPHGVKFLGPVILEVPHFASLRGREREIVILRSDDGQHWK
EHQLEATEDAVQEVLNESFDAEELSQLDDLHTSRITRILTNDFPMYFAVVTRVRQEVHCV
GPEGGVILSSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEIVARLHGNRVAVSPIVTVEP
RRRKFHKPITLCIPLPQSSNKGMLTQYSGQPGQEPPTLRLLCSITGGSAPAQWEDITGTT
QLTFTGEDVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISVPYMARFLIFARRTFPN
EGQLRLFCMTDDREDKTLEKQEHFIEIAKSKDVEVLSGRHQFLEFSGNIFPITKSGDQLS
LYFLPFQENRLAFMIKTRARTDNEAAADGRISFMKEPKMRAESLPPQTPLCTLAVTLPEY
TGPISKKPFFSEALLTEKYTEALHETAEPDDLPLPHVARLIGADWHRLARALEVPDIDIR
QVRHQLVGLEAITVLRIWMFLKKEQATPAILRSALQRIGRDDVVREINRIEKPDDLEGTP
VSHISEPSVTISSTSLEADDRRHYSEVAATQQLMVEEPFFQQSEYYGIDGDTGGPKEQPF
REEEEEVAVSEIRTVVRTERHVHDSEDGERCFDTGPIVEERTITTTYEDDVAVNEEIVDR
IVPLNEEEQEKWDRMVREAEMNLEQQKESKEGTLDSQVTHEEKKDGDDGVILKTTRMGSS
HVSQFLPDEAKTAANETGLSSRDASIVMTPTGEEKVDHIERVVLNSFGNRDGEQSVQQNT
SISAAAVAVAHDAVDFSDVMEEKRTDEEAKGQNVHE
Download sequence
Identical sequences XP_001898915.1.25112 Bm1_37330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]