SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_37485 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_37485
Domain Number 1 Region: 23-185
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000649
Family MAM domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_37485
Sequence length 209
Comment | Brugia malayi hypothetical protein (210 aa)
Sequence
MRLTVTFFTSILSKVVNQINTSADLNCGFESTCQWRNNTSGEDSGDFLITSNVRVANHFN
IIPSRNSSDELFAYTHGPFDGMQKATLISNIISCQLGGSTLTFWYYRTGDSATLEVCVRQ
PPGSLNTADLRCFPVFPKNYAHQWLFNAVEFPPLTQPFELLIRSNYIQPFDIIAIDDIFY
DAALCVYAIIEKSKKWMSLREKPRGHYMG
Download sequence
Identical sequences Bm1_37485 XP_001898947.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]