SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_37495 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_37495
Domain Number 1 Region: 113-267
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000174
Family MAM domain 0.0071
Further Details:      
 
Domain Number 2 Region: 391-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000744
Family MAM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_37495
Sequence length 559
Comment | Brugia malayi conserved hypothetical protein (560 aa)
Sequence
MLIRESCISTSPRAFSSGVSVQQFNPIPPSPPGAAIGQPQGIALVAAPQQVPNNAPVGAV
RPAISSAGRGPIEPIPQQQLLNSLLGSKITLHEFDSNGYNAEGGGPVAAGEALSCDFDSR
PCCWANVPPPDDQLDWHLANGVPDSPQFQNALFPSGNYLVTYASSSAPSDEAQFASCAIG
CASSPIVVRARHWQSENVLLQVCQRESFPNTVNFNPLLNCQEFPLVNGLGATELVLPKAS
LIDIVFVASNFVSERGDMAILDDIEIIYESDGDDCGIEQEERKAQIDEKATIASANEAGV
VNNIDASHSSLNSTSQMTFGRKKSSDEIKTTETKSLAASATGSLSSAVSSSESQSGFSGS
ALLSSPDIVPVPASSERNQVSKITTSSSATCNAIKCSFENRNICNYKEAHQTESIRGVTT
SFQVVTGQYMNKVTGVKEGTEGHYYAATFLYPREMAGLAVNIVNLKEPVRLRFQYYEGTH
GVQLKGCCESLEHCLFASDKFVSVSDRTWKLTAFICPAGTSKILFVCENTRTNQGACAID
DIQVIENGAVDLRTARTLC
Download sequence
Identical sequences Bm1_37495 XP_001898949.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]