SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_37980 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_37980
Domain Number 1 Region: 109-343
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.84e-43
Family Ankyrin repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 18-135
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000451
Family Ankyrin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_37980
Sequence length 490
Comment | Brugia malayi Ankyrin repeat (491 aa)
Sequence
MRHAFSSTSNCCNSAFKAVRSNHMHCLTYMNKKDLEQRDISGQTPLHVAAKLGFLQAIDL
LQHEAPATQDAVSIFGENPALVAAGEGQTLSVELLFSGNSKHVSARAQQRDINGTTVLMA
AVARGNNDLALWLLKRFGKKLAMLPNNFRMLPLHVAAANGNIEFIRNAIKYDRRMVNFRD
QFGCTPVFYAIQGGCFNCVRLLIEKGGADICIVSDKGQSLLHVACLAGHAHIVRWIVNRS
AANVILWTTKDNANAIHCASYSGSVAALYILLHTVSYKRRRQILALRDSRGNTPLHLTAI
NNHTDAAQYLLENGAEPRLLNNGGQTAETIAYIQKNYQLAKLLSYWKERKHKRKEWFTPL
ATNDISHVNNVYSSDYWSTSKTSNYTMPNSSSHIVPINIAESSSLQQNIASKYSSKDNFT
ITDPIEAIMGELRPITYVASDEGGRIFEDLSIQTDRDSLRIATKVLDEDEWRESLAAVAQ
IDRVLQEIDA
Download sequence
Identical sequences XP_001899049.1.25112 Bm1_37980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]