SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38135 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_38135
Domain Number 1 Region: 5-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.42e-51
Family Ankyrin repeat 0.00016
Further Details:      
 
Weak hits

Sequence:  Bm1_38135
Domain Number - Region: 362-410
Classification Level Classification E-value
Superfamily Zinc hairpin stack 0.00209
Family Zinc hairpin stack 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_38135
Sequence length 423
Comment | Brugia malayi DHHC zinc finger domain containing protein (424 aa)
Sequence
MDARQAAQFGNVSRLQELLASGECTPDTLDADDCSLLHWAAINNRLSITRILIDRGCNVN
AIGGVLASTPLHWAARHGHTHMVALLVAHGADLHLNDVEGFTPLHVAVQFGRTSTAAYLI
AAGQSPDERDETMMTPAMWAAYKVFSRDPLQMLITMGADLSCTDTTYANTALHWAVIQGN
HSAINVLIKYNAELVLRNRDNETPRDIAIRRGDVISARILEKAERRKRLISSTFIQYVKE
NDILISRIMFFLPVCIMVAVGLILHVILSYMVKALLLLLVGVFGRIVYRSLATDRSFYII
PLGAAVASKIVLAVTWLLYLHAFAGWYWQISFFILVTLAPVLFLWIIFSDPGIITVSHKE
RCEMIRDMWEKESRQAVSFCSTCLLKRPARSKHCSVCDRCVKSDLYLVHVVILNFTVVKK
LQI
Download sequence
Identical sequences XP_001899080.1.25112 Bm1_38135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]