SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38300 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_38300
Domain Number 1 Region: 357-617
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.78e-54
Family Leukotriene A4 hydrolase catalytic domain 0.003
Further Details:      
 
Domain Number 2 Region: 132-349
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.44e-27
Family Leukotriene A4 hydrolase N-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_38300
Sequence length 1061
Comment | Brugia malayi Peptidase family M1 containing protein (1062 aa)
Sequence
MISERNSLKNSPNDDTELWNVNDASSIIISPGTMDSFSSHYSFLNKKCSSWLGKSILLSL
MLTVFVFGVLLAFLIGQWVAKSEKNAHKVENSEEAVMKNITLLSVYPPLSNSITPWALHF
SLSSATAQKHRKVPLIRLPRALQPEHYDLQLDFTNVVSKEQISGNISILLKSYVNSTTLH
EVAFHAAANVHIDGVRLLHQGKVVRIERFKREHRAKVIRLQLEQPLKNGWYMLEMQFVTK
ICKDNSGGVHCYRGIRQDVNSLPRNHHLPIISFTTRFQPLLARTFFPCWDEPSWKAIYNI
TILHSTSITVLTNAAPLHFIQKQRHSFVRTTFRETPPIPAFLLAFAFGPYSNLERSTGYD
VPLTIWTFPEDLVYAKFAANFSPYMFDQLAKEFVVPYPLSKIDFVAAHSFPVSGMENWGL
IVFQKELFLLDSLLESSANMTVDLLAEQYDIEKIITHELVHQWFGNLVTINDWSELWLSE
GFASYYVNYLLKKQRPILATNEYFLRLSQLLSRQTSSEKVALVKVFKTEEEVENAFNPYH
LYTKGAVIVKMMCDLVGKDNFREGVRRFLKTNAYKSIGRSALWKAMPAYTDHGLQNKKLE
NVIEPWLLNDGMPEVLVSEPDLSRNYDYGSIRLIPRPSDQNRYVTYLRGASTRHYNVKYS
KETIKKVRMKKWIGRSKKIEVGNANEKSYFYVESVNKQRSIENIWTNSKKQAAKSKQIVD
GDQSISRKKERHYRKIKENRRSVREKQFWSIPFSYQLSSKTNVFADTIREFWLHNKTVVL
TDKKYQTSAALLANVNWKYPYRVNYDIENWKMLAKLVTEWLNKVMDDTKAKPELAALWLL
DANRLIQFYKLRCAVNLSTCDPEHKVQQWLKSGGLTKGDHYSQMTAICHHLFTQGTKDGH
DVVENGLKQFSGKWTTTIQLATCVRNEHILKKVASQIIATRNAAVYTAMLQNEFTLLYNK
KFRALFWKEIADMPLIERKLLFSTETDQTAQVAQTLVHSIRSFSELEWLVNIVPDWGPYM
KPHIDYLHRKFQWIDEIATPRIEHFLLKVIKAVKKKSVTAR
Download sequence
Identical sequences XP_001899113.1.25112 Bm1_38300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]