SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38540 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_38540
Domain Number - Region: 62-94
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0432
Family PHD domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_38540
Sequence length 151
Comment | Brugia malayi hypothetical protein (152 aa)
Sequence
MSRTTLCLKKALKEHCYVRRRKSWVGEDLDPPTKELFRLCIYNELLFSHVTITVQTEIYK
STCNLCENASHIMSIGNCTMKTVPKKLFLCQQCNKTLCSSCEASFCIPKLVEFLEDVREA
EKSPDMLKKLCTLVALNSSDHDAARALVNIH
Download sequence
Identical sequences Bm1_38540 XP_001899161.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]