SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38565 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_38565
Domain Number 1 Region: 34-142
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.09e-29
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 2 Region: 157-244
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000144
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_38565
Sequence length 775
Comment | Brugia malayi GTP-ase activating protein for Arf containing
Sequence
proteinXXXXaaXMIADMSSQYVTSSVAGRPFQCADCSAADPQWASLNRGVLICSECCY
IHRNLGRHISHVRSIKKGAWNSSQLELMYVLYSNGSNNIWEHSLLDPQSTNKIRRKPTPH
DPVLPIKENFIKAKYAQMAFALRPAKDDNCISQDDLNRQLWSCVRTSHVETTMRLLALGA
DPNYTDPEKHNTPLHVSAKENQALQVELLWIYGADPAQLNAIDLTPSQVAKLENHIELAA
RLEQLQFEVTNRLTMFLCGRRPDHSKQQYFLIPELAGQYTENVQMKSARRRLRSLPSYYF
ERFVQDVYDEVDRRETVTAWNAVIQGIQPFSLGNDHCVAVFLPPNPELSATRNQLRQKLA
KCDVRGFATLIIDILSEAKRRYYGLPLKNDTDDSAENLLKKTSDSMDRLNISSMGTSEYF
TSFSEQDYRDYDEVADSLQNGKWRTSGSTRKSSERKSDDSGDLLQETGPVMIDDFLELKE
KLANTEGTLAAVQQTNTQILRMLTHLQSNIDRLNADNADVHDQLKKVKTTCSQAVGRRRS
SQSPALSPGTSVSTSVLGSKNITSTYHASTEKSVTASQNPDMHGAFGRASRRHGLTSLMN
TTGRTIAQHRSFSLRQGTVQQTEYSSGVEGLDPHFGISCCEKTDLLNAVDERTEEERMRS
SYRSIGAFTDNLIAETEQLTHAIKLLLTDAQYGQLQARAPDHAYSVAILISRILTIIPEE
RRTPAVETCLQRMSDSTVILSAKCNAPTFSVNDTCAAAFAVANSAKQLLVNVHQF
Download sequence
Identical sequences Bm1_38565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]