SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38590 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_38590
Domain Number 1 Region: 1510-1679
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.04e-35
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 2104-2293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-31
Family Laminin G-like module 0.00024
Further Details:      
 
Domain Number 3 Region: 1938-2096
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.65e-31
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 711-730,1309-1492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.92e-27
Family Laminin G-like module 0.0079
Further Details:      
 
Domain Number 5 Region: 1704-1850
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-16
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 6 Region: 113-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 546-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000893
Family Laminin-type module 0.0038
Further Details:      
 
Domain Number 8 Region: 438-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 22-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 10 Region: 646-695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 11 Region: 74-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 12 Region: 495-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 13 Region: 161-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  Bm1_38590
Domain Number - Region: 393-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family Laminin-type module 0.048
Further Details:      
 
Domain Number - Region: 599-644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family Laminin-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_38590
Sequence length 2293
Comment | Brugia malayi laminin-like protein K08C7.3 precursor,
Sequence
putativeXXXXXaaXMAALPCECNSQGSTSFTCEEYGGECSCRSNIIGRRCDRCAPGYY
NFPDCIKCKCPDNHLCDENTGQCFCPPHVEGKHCDSCVPYAFGYDPLIGCQLCGCQQNGS
EARQLQCDPDSGQCLCKVNVGGRKCDKCLPGFYGFPHCYECACEIEGTTEEICESTSAAC
KCKKNVIGENCDICRPGTFDLRASNSDGCSECFCFGATDRCRSSFLPITFVNFDEEAWKI
YPNESVLHTHGKVVYEAKIDAKDDVYFLAPIRSGHDYTTSYGLQLSFVVLSNPRDGETKM
NSAPDVQLVGNNTVLDFWAREQPVNPRIPFNVDIILLPENFMESTGEPTTRDTLMMVLHG
LDELRIKACYYTNCELASISELQLEIAKDDQTTSDSYTASSVEICQCPLPYTGLSCQQCS
PGYYRVNNGRYLGSCVSCNCNGHSGSCDPSTGICFNCEHDTFGDHCEFCRVGFYGDATKG
GPYSCMPCACPYATNSNNFATSCQVSETGLLESCFCKEGYTSDYCERCDIGYYGQPTAID
GSCHKCNCNNNNNLEVDGSCHPITGDCYLCLNNTDGAHCEHCKPWFYGDAVEAKNCTNCA
CNQCGSSLCDSRSGKCECLANVEGEKCDRCVTNAWGFIRCHGCEMCNCALASSSPQCDAE
TGQCSCMPGAAGQMCEICEYGYWNYGPTGCSKCDCEADLSMGTVCDVNTGQCHCQEGATG
PRCDQCALHYVRIPNLGCRLCDECVHSVTHDLDKLTDAVALVNETVNNISTTALTGARLK
RIHKKINDLKPIVVNHMNSSSDVDIKSLSSSGILDTTSNVVSVIVRANRSLDTLSTMGST
LNGIINRTNIFLSGVFNRVESAASVVDSLKNLVFSLGKDSGAVYNQKWLMNSNSLLQKIR
DSANDEDARKRMKDAEDETQKLLSRIRQLKNKDNVMYTKYFTVRNQMDRLMNNITDYHSF
LYRAANSVENTLQQVNNSNIRHINSVQAGVKAGGVRIRETHAFINSLKETSEISIESLSN
LNKTLREVISEVQVVFGQLNITNGRYRHRWIRNINKNEYRGKSKELESEALFLSSLFGRT
RTEAKNAVAAANGYKELIEHLKKARDVANHTSLNAEQARRFHEEGVAASARTFREQSADL
LRSAVDLKQSSVNNVGGLKDIFLGKALELQFFIENQKRILDSLHPKFDDLEVNAKLEHSL
TASEEARTRTDSTIFLFDRFKPNLEEMVSRSKKLVESISLSANNVDTAREQILKLVNESS
PIMEELKMQQHAALNISATIEHCREKLNLLKEKIALSRDLANRINLGAHFEKGSILELPL
PPRITRFAAYTDIDFFFRTTNTSGLILFFGNELGVAGTRAVPTDDYIAVEVVRGHLRIVV
NLGETPTQLISDSFVTDGNWRKVAVERVGKTIKLRLSSPSSVNYEEEKARTIGGFKSVLN
LHQKKSRLFIGGVVPGVNISPEIHNREFTGDIEDLRIHGETVGLWNAKKGGNYNVKGAMK
KIFATSLTNEIALSFNGDGYAVYKLGIWNPRKQTIFSLTFQTYSPDGLFIYLGKERGFLS
LELQDGRVKLSFDFGSGVARLTSTGNNYNDGKPHCLYVHRLERHARMQVDDSDVSEGDSP
GTMFELSLSDVFYLGGVPSDVSTRTAVVSMNGCIEQVKLDNRLMDLSKSRTARGVQLGCS
ARNVRVVSMVSERSIATFSGFNVKEDYLELTFRFKTKRSSGILASVISDEQEVLLQLRYL
NGFILAEYGSDNKDVAQIEFRSIADGHWHYLASIVKPETIRLDLDDLYSNEIRRSVADNE
VVGVPIIVQFGQSLDSNLYFEGCIGDATYNGQLLDFAEASTNEVGLTDCSFLEDISTTDM
SSGQATRNQPMNVSIPATNSMQPVVTETDNEFTAENRISSDTPSLTTLRGIVRKSDECAL
LKRSYGNRPNSSGTRFGLSPSSRLEFDKPPSSFDKNSLFSIQLRATASNGIIMFTTNNRH
TDYLALYLVNGIVHFAYNSGSGQAVLKSNRSVMDYEWHSIRAEREGLAGTLYIDNVMEAN
GQSPPGTDTVDTQPPIYIGGLPTDLVPFASRILQGAKSVFGGCLRDFKLNEMKFDVPPVE
IGTVPCSHYTEEGLYFGENGGYAVLNKNLKVGSSFNIELEVRPRTKTAVLLSVGVLEYLT
LQFSNGTVKFTVDNGAGQETVVHVPSTTNALCDGHWHHIKLYKTKNLMTLTVDGRSSLNI
MKKGRKTDTNTKDPLYLGGVPKGIKTRSLETTDGFLGCVRVLNMEKKPRKRKNIDLSQVS
LFGDITKNSCPVN
Download sequence
Identical sequences Bm1_38590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]