SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38605 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_38605
Domain Number 1 Region: 163-249
Classification Level Classification E-value
Superfamily Immunoglobulin 3.08e-17
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 60-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000196
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_38605
Sequence length 255
Comment | Brugia malayi Immunoglobulin I-set domain containing protein (256 aa)
Sequence
MLHVTVFYLLILTSLTISTLRQRDIFEKSHVVETDIGKDIEVLNSNFNAEHLTEAPYLHF
TKTPKAVEIAVGNELVLKCEAIGIPPPIIEWAYNGNIIHAIVESNAAEKLHNADLNTIQY
GVTASKMVVPCIKTKDTAEYKCLASNGHQKLEKEKAKCWRKHSPPVISMWTDGRFEISGA
TVQLFCRVNGTPQSNITWYNEENCKLDNVKKYKILANGDLMIYDTQWEDLGVYTCIASNE
YGEDRIMAFFYPTEP
Download sequence
Identical sequences XP_001899174.1.25112 Bm1_38605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]