SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38695 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_38695
Domain Number 1 Region: 10-51
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000709
Family PHD domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_38695
Sequence length 171
Comment | Brugia malayi PHD-finger family protein (172 aa)
Sequence
MSIVAEKIKAGQQTHCLCGSSDESSFMICCDHCGVWYHGACLQVMPPSLHLIAKNPPCTE
KDGCSLLLEPKQIVSKRMRALLVLAKTAKREREKSIHCEKQYKSKGSRNNIKIQSRLRRS
SKDDHGLIVTSHVDRFFHCEDNKKSVVKVATTALTAFDRQIVVNVQTVLLL
Download sequence
Identical sequences Bm1_38695 XP_001899192.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]