SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38710 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_38710
Domain Number 1 Region: 15-347
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.83e-47
Family Ankyrin repeat 0.0000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_38710
Sequence length 401
Comment | Brugia malayi inversin, putative (402 aa)
Sequence
MRCCPELVLLRDVFGQTALMCSVISDAVSLTKALLVYKGGRKQWLSKQLKSVDPDFRTAL
HHAAAGGRVLQVVLLLECGATVKGQDSYGATPMHYAAVRGFCATLKLLYKANKYADEIRT
NDGHSAFMWAAKHGVSISIHTMIDANPVVNQEDCDSYGCTALHLAAAGDHVEVINTLLLL
KWNAEKRNKLGETPLAVAAKNGSAGAVLCFLHAGVDFFSQDKFNNTVLHMAANSDSKKET
LHQLLHYLKDSSLLNMRNNMGQTPLHCATEHNALQCVRYLLECGADPLIRDNRGWDPLMV
AVRQGCWSTIILMLKNSSNINCYSAADNQTTLSLALERKNYILASFLEKNGALLASEIQD
TAARMYDLFLADFYADSYPYFNSVHQNYQLPLNEKPHGLVH
Download sequence
Identical sequences XP_001899195.1.25112 Bm1_38710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]