SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38715 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_38715
Domain Number 1 Region: 10-204
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.1e-24
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_38715
Sequence length 286
Comment | Brugia malayi conserved hypothetical protein (287 aa)
Sequence
MIQSNSYNFNSLHIDIDNYLLAVRAAVTGDALHLLYLTNVLKVSVNAANLQGMTLLHWAT
ANDHVDIVQLLLSLGANSRLITKKGRSVLHTATYNDAARCLKLFLKIFFEQEKMFSMKNS
YGMSYKFILQRDFNGDNLLHLACRLRKKRCLKIIISFIIKYLGWILVEEMLQQCNQDNQT
PVHVACLWNSVEAATLLLTDNLNKIVRKVYNSVKGSVAVVALKMASKRTLFWRIERGTVL
HEMATMKCGFACFTKNSSSLLEYDNKLAACTMTEIFEKRCPECEKG
Download sequence
Identical sequences XP_001899196.1.25112 Bm1_38715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]