SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38780 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_38780
Domain Number - Region: 346-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00127
Family MAM domain 0.024
Further Details:      
 
Domain Number - Region: 40-136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0013
Family MAM domain 0.017
Further Details:      
 
Domain Number - Region: 548-648
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0222
Family MAM domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_38780
Sequence length 657
Comment | Brugia malayi hypothetical protein (658 aa)
Sequence
MAGYGYERMKLKEYLGIEWIEGGFDETDQHDNKSIRHANDLDCTFDDIKKCQWRNVREKE
ALDSLDFHLFEKIDFKEFPVLQVRPGPSRLARGDKLLFTGDRKQEEQTAVLKSSPILCQN
STGILTFTFWLYNGARVEVLLLKQKKDRLVILPEKPFVDCGTVLLNTECTAEIPPRDEEF
SKGSLVKAAHDLNCNNFTSRCRWRMVGYGLEMWQIADESPSNELMFNATGALPVPEAPFL
FMYIEQNRHGPFNVLQSDPIDCQIENTSKFSFRFWTTRNVALEICARDRSLNAAECHLVP
MALSPALLTVEVKSINSDYDNFIAIDDINYEGTFCSEAVNAWDLDCMWANHEQAEPAWQI
GTTPLNKHKFISLTGTSELPDGEFAVVHLKSGQASTLITEPIRCISGQATLTFRFWLSGN
TRLDVCLLEDKILEAVDCQQIVLKQPGPALVDLPGMNHPVRIALKAESSSQGMALIDDLV
VMGDICPSVIRHHGVRLFGSGLAQIPDPNVCRLLSCNFMEGQTCLYSSGRVALSQSNFKA
RDGAVTAFLFKKGKVAVLESPTFRLNAAARIHFLYRNDANTSVVFVCHDSISRELESCFK
VRGDSAGHGWHHDFMEVLPSDTKFYMVAKLADNSRSARVSITNITVTDVDNNIACSL
Download sequence
Identical sequences XP_001899209.1.25112 Bm1_38780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]