SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38910 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_38910
Domain Number 1 Region: 25-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000141
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 108-202
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000122
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_38910
Sequence length 247
Comment | Brugia malayi Wrapper/rega-1/klingon homolog protein 1,
Sequence
isoformeXputativeXXXXaaXMPVRLDQDINLTCKYNAEPSPQVDWIYNGFTINFSD
DKFKGLIQYAARRDNYSESILAIENIKEDNFGDYTCRIANNLGIKEKTIYVSGRPGPPHL
NASGIRLSWSVHSMDPVIEYQILYRFSNDDTWQQFKSIRANKEEQDGDIWSGSEDLVWLR
PGLEYELQMKARNTLGWGSLARSYVIMKIPPFDNVTSDKKVNAVKRIYASRSCLSVVSFI
AASIFRL
Download sequence
Identical sequences Bm1_38910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]