SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38925 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_38925
Domain Number 1 Region: 393-630
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-35
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 2 Region: 724-975
Classification Level Classification E-value
Superfamily YWTD domain 9.68e-23
Family YWTD domain 0.00037
Further Details:      
 
Domain Number 3 Region: 82-336
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000157
Family YWTD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1065-1254
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000706
Family YWTD domain 0.012
Further Details:      
 
Domain Number 5 Region: 667-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 1390-1433
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 344-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000108
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 8 Region: 1439-1475
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000537
Family LDL receptor-like module 0.0027
Further Details:      
 
Weak hits

Sequence:  Bm1_38925
Domain Number - Region: 990-1042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000544
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 1481-1519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000615
Family LDL receptor-like module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_38925
Sequence length 1788
Comment | Brugia malayi Low-density lipoprotein receptor repeat class B
Sequence
containingproteinXXXXXaaXMKANLFTIAMYYALIERAVLTKVPVLARQRKTITQ
LTLDIDKTVITSATEIVSGIDESFPVLIALDFSRNILAYMESWQRSSSGNIRVIALDNST
VPSYIQRSSGVAEETVTSLAIDWVTGKLYVGVETASIHNAGRIEVCPLDGQTTCAIALHS
SFENLNSRVDALHSLVLDPVDGYMYWLNRVHKRIERAWMDGRHHDPHCFKDDTIGVVATS
ALTLEQVSRMLYYVRTRTSLDESQIWSCSLYDRESCRTVASKVNAFYLDVFSDYLIWTSV
TNQNSGITVCEKMDCDRTTREMINSSGVEALVVFDEEVQPLKQSLNPCESKNGGCSHICV
LIPGAPWRSCLCPVGVRLLQDRLTCSPNGIESLLYVATTSGLIFISLDTAHHTPLPLPNV
ASEIRDTKVVHIDFDPIDKKLFMIDGDMGVIRRCNPDGTGMEVFVEDSDKLVSDALAVDW
LNRNLYWLDSNVAQIKMQSLSSKGRQIVISHGLKQPRGLALDPDGGYMFFSDWHESTSRI
EKAWLDGSHRRVLVSLEKNAWPNGIVVDARHKRLYWAEGSRSFIKSVAVDGTLDVQVFAE
SVNHPYSLTILGNSLYCNSLYGRKISVFRVPRHNESVLNVQLSVVSDSVIFGQMGIRAVS
LNHIPEGVSPCQTSNGGCSHICVKLPNGKRGCVCPVGYELQADNTTCILPTAFLIYTQSP
AVNTANSIMRISLETAPANNHRINIADMTSAPVSVDINQRIFWSSEGHGRSIRSLLRSAF
FNGSGLETVYEGNAVNYIAVDWITSNIYWCNMEQRRIEMVRGDGRRHRTIAWENIDPRYL
VVHPLQRFLVFVNYYNQQKITINKIPLHGEQSGGQVIVQQLDTVNALAIDFESELLVWSE
LNERGGGVSISDFSGRNRVRLVYSEQLLPVALAVYNRQIYIANMNSNTIDLYSGHALTVL
HDGVSHVSNLVVAHAQISKGESVCSLEKITSWNGCVQNNGGCSDICVAVSGSLYNASAKC
FCEDHFTFDDVGGKCLPPKHFLLVAVRSRFIRFNLRQTDTDGVFWKNDPYSILSITDVGT
PVSVGVDLFSANRSIYWIDSNDDKVIKRSSDLSQSMTQTITLSKHSNCAILFNLAVDEVG
RQLFVSCAEHGLSHASSIHVWRIKNNDHLEYIGVVVSGRERSVVTDRPPYPRQIALFPRL
NLLFYVDDAASIPVIVRCSLNGRQCVQWETPNLMHTVKLHAFQINDRLYYTTANGLWSRD
AHVFSDVRHHVKARPSDLDMVPINEKKLIIIAKNESQLEYDDMLLELMDDIPTVSLDELK
WSTTSPFSVKHILALTVVGSIERDFYVNLNHTCAVSHCSHLCRVPRDSRKRHECLCPLGF
GLQTPSETFCFKHTSCLHWQFKCDDGQKCIHAMAKCDGHYDCADGSDESSHWCGNIAFDK
WPCDNRKASIARALVCNGAEDCADGSDEAHCRCTNPLFYFDCTFGLNAALHPAECIRREL
ICNGINNCYAGQDEEKQLCAEFVATVTVATAISPSFELIIPLAVFFLALSIVSVCCCHLS
KQRPPGQNLSHATTHSLPMNAEPLVLLPAHPDDTQIELHTYSVGASSLYNALPPPNSRLS
ADTISYLHSLNGSPSEKGSMLTAVAKANSRKFFAPPPSAASLSTYGVVKPAGMRVHLQHG
GTVSTRNRRKQRNHSRTVGITRTYSPPPSYSKVKTTRPVHIDMGCSGEESQQLQVPTNSR
IISSIDSSSVESMGHVLLPSSNFISSVECTHQQHLLDYSSTSSDVSLG
Download sequence
Identical sequences Bm1_38925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]