SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_39175 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_39175
Domain Number 1 Region: 131-220
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000952
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 2 Region: 11-70
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000575
Family Ankyrin repeat 0.0077
Further Details:      
 
Weak hits

Sequence:  Bm1_39175
Domain Number - Region: 711-787
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00138
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_39175
Sequence length 800
Comment | Brugia malayi conserved hypothetical protein (801 aa)
Sequence
MNILNSNGALLAIETNDEDMLRMILSKTDIPFGVRINDAYLEEWTLLEFALMLGHRHCAE
VLLQSGATINVELYPLERRLQQVQENAQLITEEIRFLWITNVQNEDKHIKYLERRLSQME
KMKAVLKNAFVPGPPNDVEAVVSASDQLTVTWKDVHQHNVDLIINYKIEWSLCDDFNSIE
GSLLVDTVLRNYAVISDLKRGLRYSVRVSAASIGGFGHPTLATPHSLLISMFPKSSGISD
KKKRRNIRSLFVSGFQSLKVIQRGIYLVSIIYSQMKVCTVEDCLPVILVDQTQFCIEKNE
MYWAIKLSLAWGEIQTLQEANNSSSPNFRSKFIDAAIEMHTALRVKDIGRVYYQPIVDEI
NSISFIVTVRFVNGSQNAQGLTTKWLPLSKIVRKRGACRAMDVLLAEIFKIINFFESSHV
RLRRGLYIYNPHITKEEWDLLRSVDIKVSNSLTPVQFVFYTALVKAASRLLIDLEIDINF
MPNQRIYRLQVFQPQFDVSFIILLPKIEDVCTVRSYSLISSVQKGCFTLPLQVFEAIHLC
TYNPDFIGTYCRLSVFIEHFSTYIQYEQRNSLLEKDINIYADVLSKLDEFRHRLESTWKS
VRWIGDVASIARDKRTKGVVSMKRLFAVSNGMNDEVRHNEQGTTSDKQDSTDSSTLYFDF
SYMWPQSIISSTNSLTGLWLRNCSQPKKTPTTRVIKVHAAYQCGFTCSVRLQIAPTTTAS
EIVALVTERLAKAATESGKRFESKDPEDFCLTVVVGSRERRLRDDFPLMKLQNPWGDGRL
FVRRRDSVLAALQRGNETAV
Download sequence
Identical sequences A0A158Q0A2
XP_001899289.1.25112 Bm1_39175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]