SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_39775 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_39775
Domain Number 1 Region: 72-204
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000134
Family Ankyrin repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_39775
Sequence length 333
Comment | Brugia malayi hypothetical protein (334 aa)
Sequence
MDVLCQNIQNFSADLTEGAMDSTSSHNKPFAHMACERWLHARLDNLRTKSVFNHRTEYEY
LPQKLEKSFVDFNVKEKNIRGETLIMSVIRYELDKANQVRYINLLIRSGCDPSEPDERQL
RTPLMLACLMRNDTVAHHLILQNVNLMAVDKMGNTVLMYAAMYSQSSLLNFLVEELTRRW
CIEAFRTKNLMGYTAESLARKNERYMFSMMLKKGRLRLVKRLRDQVSSNLMFAPPFNNWN
TYSSIYKAKQKFLLYAQRCVQTFQHCTSSAAESSKSSLPLLHSINSRFFLKNCQPKTNPK
PHSTMEVNINLPPLSQSLVNASTVLSGKQGTVY
Download sequence
Identical sequences A0A0K0IQ78
Bm1_39775 XP_001899410.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]