SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_40085 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_40085
Domain Number 1 Region: 301-567
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.41e-50
Family Ankyrin repeat 0.00039
Further Details:      
 
Domain Number 2 Region: 667-971
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.71e-42
Family Patatin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_40085
Sequence length 1017
Comment | Brugia malayi Patatin-like phospholipase family protein (1018 aa)
Sequence
MTDLNTSTLEPITVDINSQISDADDNKTESEKTVEINDEQIGTASLLYSDLTTTISKSSL
KLSSSREIDEARANTETTTTAVLSEMGSIPSAALTSEEGVPTPPPSPTVRKTSVKPSLFS
LAQVSHKLGELWSSARERVFGEDYWIPSDCYEVVPFPVELLRAHNSVYPHSNSRKGLRVV
QGTLKNRPAAPLFHVLFSKENEEKNDNRREEVELLVTVSIFRTHEIQEAIDLCNRCYDCE
ALFMLLDMQNDNRRLVRDLVTALRAHPLWLIVPIAIATNRVDFFTNESIKRFQATNEDLF
DVMLQVTAQPEGRYPLMLAIEMHRLEIVRRLLELGADPTARDIKGNNSLHYAALASVTML
ELLWEFEKTHPLLNTTNHDGYTPVLIAIRNANPRIVSTLISHGAEVNIRVAGRSPLFEAM
QSKGKSTEVIRTLLEASPKLLHEKDPATGNTVLHAAQFKTPLMGLLSLKHKELDLNARNN
AGQAPIHMYVSRGDVGMVMTLSSYNCDLNVSDQSGDTALHLSVSRRDLLMTRLLLCLGAD
PNVKNKHGETPRHLASKLQEWDLVKSLAICGARRCDSGGKSGCVSGCVNGKKLDEMKDAS
WSLIESAENYMIPRTGSSAFMDDLETSVDVEVSNSIQDFKQKFCYERMMKRLEELAAKKD
TPDFVCLLSLDGGGIRGLVIIQMLLELEKMMGEPFFSYFDMVAGTSTGGIIAAALALGKT
LRDCQQIYLRLKDLIFDSWARPYNTSLLELFIQAEVGTDMTLASVPWPKMILTTVRADCF
PVRLELMRNFRLPLSDEENSSLGYADPADTLLWKALRRTSAAPTYFSSVDNRYIDGGIIS
NNPALELLSELAFWNTTNHFLTSSENNAIQLGCLLSVGTGAIPTMPLSTSNLEISSNPYS
SAVAIKNLGVILVEQVTATEGAPVERARSWCHNMNVPFFRLSAPLHKDIPMDTRDDTDIA
RMMWDCVQYCNTMRCEMEKIHGLLRKLGPAWRRRHLFEARKSDDDAKLQTAGRSDLI
Download sequence
Identical sequences A0A0H5SB61
XP_001899472.1.25112 Bm1_40085 Bm6221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]