SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_40320 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_40320
Domain Number 1 Region: 20-101
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-16
Family I set domains 0.033
Further Details:      
 
Domain Number 2 Region: 106-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000213
Family I set domains 0.031
Further Details:      
 
Domain Number 3 Region: 208-310
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000153
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_40320
Sequence length 321
Comment | Brugia malayi Disorganized muscle protein 1, putative (322 aa)
Sequence
MPEGKAPHFPQQPVARQNDDGSLELECFLEAQPVPDIKWFYDTTELKQDQRFSFRLDNKG
NDAYSAILQIKDLADSDAGAYRCAIVNPHGKGNANFNLKLTGFSAPTFVEKPQISSRDDG
QVMVMEFRAKSILKPTFVWQKGEEIVAESDRVKIVLREEANQTYYAALEIKEPTKEKDAG
QFVCTAKNESGKLTATFTVKFEVPQGAPTFTRKPQILQKTSDSGDPAIVFDIGFQADQNP
EVIWLNPKGKKMKESSRIKFGLTPDGGANTFTAQLELKNYKAKDSGTYTCNIKNEAGEAN
VELTLNIEGPLDEGADDASEA
Download sequence
Identical sequences A0A044TP14 A0A0K0J5A2 A0A182EGA2 J9BM32
XP_001899521.1.25112 Bm1_40320 Bm2290 OVOC5227 WUBG_00520T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]