SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_40760 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_40760
Domain Number 1 Region: 34-179
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000013
Family C-type lectin domain 0.0071
Further Details:      
 
Domain Number 2 Region: 639-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000945
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 1473-1607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000014
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 4 Region: 403-463
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000389
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 5 Region: 2013-2147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000119
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 813-884
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000126
Family I set domains 0.043
Further Details:      
 
Domain Number 7 Region: 2187-2224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000215
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 8 Region: 345-412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000222
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 9 Region: 2225-2269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 187-228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 11 Region: 2144-2191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000321
Family EGF-type module 0.017
Further Details:      
 
Domain Number 12 Region: 243-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000458
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 13 Region: 518-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000559
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 14 Region: 2269-2302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000944
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  Bm1_40760
Domain Number - Region: 1986-2026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000612
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1038-1111
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00159
Family Snake venom toxins 0.066
Further Details:      
 
Domain Number - Region: 475-526
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00181
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number - Region: 579-647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0474
Family Complement control module/SCR domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_40760
Sequence length 2304
Comment | Brugia malayi GCC2 and GCC3 family protein (2305 aa)
Sequence
MISTSSIVYLSVLFGILLANFQYNYHIGNVKFSCIEGWNLYGNSCYIVVQQELSWIDANN
LCASQRYNYSRSIALYDWFLMRDMSVSLLNSTNNYWTAFYYRGTKDAKRQDCRAHDAVLH
AKYHSYTTSIYNPLWSSHQSGLENCAVNSCIYMYANFSDQTNYGWKMENCSIKHSTICET
FACLEDYQYRCNDNSKCYPRKGRCDGIQECSDNSDEAGCSKKRVSCGKTLFEEATNEISF
EINSAQYASCQWTIRQPVGNKIILTLVNITIRDGDELVISGIQNNTVSNSTSISQMLLNT
STVKEQYISVDNTVIITFRSQNTNLSVANMLDVVLKFSYIARGMYCFLPVIAYGSVVNVT
GFGIGHELYFKCHLGYQIPFGQSFSSYCYNGEWTPKPKCQTLSCGSASVVYNNAILTGYT
RNATLYSRALYSCETGLQHKGSSPPFRLCTENGTWSNPDFFCQASLCYATSFAYGHFLDQ
FYANGTAGKYVCDEGFYQKDIDPLCISGRWKGVPYCYHIDECSTPGYSLCEFTCVNTIGS
YECRCPDTHWLYTDPNSVNNLVSNTEFLIPNRTCIEKRCPAPEIPPNVIPYPLYTDPFSY
HNGLVQIGTIVYFACDHSAHNYTSFICDKTESWVMLNDCLDVTCKPLEITKQNLMIWPIK
KSYKFKDKIYFFCDEFYELNGPSSSYCIDVDKWSLSKLPDCIVRQCPGLQLDDYETIPVN
NKQDITEDHLRMFFESATHIKDTPGYSLFIKCKNGANFANGQTKIFLLCMQNYTWNLDSI
PACIHQEDIQRNYSDNGDAMIKKRYSKNCIRNTTSDIHVAVNTSAMLWCFLSAKCTNITL
IKWYRDNRQNISGMPLKGENDSWGLFFESVKVIDDGRYYCVALDTNNELLEKHPVDLFVY
QTFETGRSWPDIVQNSEPVKDLSDNLFQKEICSRYSNLFVGIRGDVNSVIVENVKIYTIK
CPEVRVSFAFFPETTAAKDGSIVSGRCLHGAHTNIKGQHPQLFCTQHGKWIYNAQSANLC
FCSANYTSENDACVERGPICYVCSGNNKTNCDDSFAVFCDKNQFCFTQITKTLEGDVTLK
GCTNECNANRIGCKTREEACEMCCQQDYCNSWKNTLKVYGEHLRPYPMFKAICPRNIAVL
RYSKGLLATATIIPPLIYNYEPFYNLTVDQNIFNGTVQFIKERNVIIWTATNRMLQFRNC
STYIVCKDYWAPVLDCPSLYIDLLTNTTSLQFRSRLPEISYHDFGSHVSLHYTPPNGTIT
EIGQPLQVTVTATNESNNSTQCVFWYIGQVADCPLWPVNETEYECEGSVNHRVCKRRHKC
PGIEFPSQVTSLNCMAGQGWSYMSPQSIVNVPLNLFRTPICLQSSAGDVRLSVNLAISSH
LNESCKAALVDKVHELPEMHETKGCRQLKWTFAGLLITDNNLFINYTMRHENTSTTLNCA
AQFVRQIIKGKLAFNVLKTICKDIEFNALSANYSTGCFKDECAPGFYAAANGCYPCPLHS
FSETVTAKNCIRCPENTFTAKTGSYSSKLCRKQCPPGFFSPTGLEPCQACAVGFYQSHYG
LQYCNHCSSPHTTSTVGSVSASECVLKCRPGWFSRTGFEPCIKCPLGFYQDRAGQTTCNA
CIIDVNKQMSVNNHCKGNAMFYHGKEYIIAWNEETRKCWNFSCRKLGCKNNGLCSNGRCI
CPLFYIGLDCSVALNLCLANFCPRGEECHFDGVTTSCLPTNNSSLEDSGMKEWQNLWKLN
QQEQKQLLDEEIQKAANESSLLTAMIFTNISVRLHTDSKLIAKQLPVRSQNPRIKRKVNK
EAVMYIGNRGIISDPSQSLMQFISNQLTSSEIIATRRWKNGGDKIQSTSAASTALAAVSA
PYAVPQTPCSHRLNFCKNGNCITTINGTINCICREGYKTNGNNNCVLLQNCDYNPCGQDL
CINIGNDYFCQCSVAQNAFYKQQWCPINKECNQKNQCKNNGISVCDYKSRCICPTSYFGD
FCTEKVEPCKNLPCYHGICIPQFHHLWPYYFCKCDPGYYGEKCTAHAACVDKNIHCKHGS
CRKNDQTAYCECYPGFTGTDCSVEINQCNSSPCVHGTCKSKFLGYTCICDEGFKGKQCEK
LIDPCDEKPCNLNSECLTLSYGYKGKFVCKCAEGWTGKYCTELIDFCIHSQCISGSTCIT
RSGVNGDVDYVCICPPNKAGIFCNESVDYCKPMNPCLHDGICQRKDDGYACHCKPGYRGD
HCQHSLCSPNPCQNNGNCTILSLTSYSCSCPQYYEGVNCTAVKNVCAISNFEDYCLNNGK
CISNNSEPICHCTHQYEGRRCENS
Download sequence
Identical sequences XP_001899611.1.25112 Bm1_40760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]