SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_40830 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_40830
Domain Number 1 Region: 321-465
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.38e-20
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 133-273
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 474-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000624
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 4 Region: 103-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 501-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000373
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 289-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000035
Family EGF-type module 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_40830
Sequence length 682
Comment | Brugia malayi Fibulin-1 precursor, putative (683 aa)
Sequence
MDTLLEHNCNYGIKMAESEDQCLLNITDIGGGIRKECCECCLLAKELSRNDKSCVAPNGF
GAACLRSFHQCCFENAKSKQYHRYESNSDLLDLLSVGDRCISTKCEHLCTDRGGATVECS
CHPGYELGPDGYSCIDINECDARDSVCPLPNSLCLNTPGSFSCVCLPGFYWSDIGSVCVD
IDECLLLADDCLESQRCLNTPGSFKCIRTLSCGTGYALDSDTEQCIDVDECNLGSHDCGP
LYQCRNTQGSYRCDPKKCAEGELMNPRTGECTNMDCPIGYKPIRGRCEDVNECEIIGRCA
QFEECINTPGSFRCQERGNLCTNGYRMDRDTGFCVDINECADGTHFCGDKQCINLLGSYK
CRCSAGFEFNDTTKRCEDVDECKKFAGHVCSLHATCENTYGSFKCHCKDGFKIAKDARNC
DDIDECSLGKANCAQKCINIPGSYQCICERGYRLGADGVTCEDIDECTLWAGSGDDLCMG
RCINTPGSYKCQCPVGYEIQEDGRTCKDVDECAKGECQGNDQICVNTLGSFKCHVIRCPL
NYMHDKNYKNRCNRLSHLCDSLTEEACKNHAIRISWEFTSIPKQEPISSRRTSITLFTVR
GPTSPSSNVQFELKLKSAIPEKFYVLPAVRSNFLLQKSEEKNGAIIALRDSLDGPQEIWI
NLPTFCRNFLLDFEIPGYIMDQ
Download sequence
Identical sequences Bm1_40830 XP_001899626.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]